PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 601aa    MW: 66410.9 Da    PI: 6.8015
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2066genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.92.4e-2788170185
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                  rW++qe+laL+++r++m+ ++r+++ k+plWeevs+k++e g++rs+k+Ckek+en+ k++k++k+ + +++  + +t+++ dql
  Gh_A05G2066  88 RWPRQETLALLKIRSDMDVTFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVFKYHKRTKDVRTGKS--DGKTYRFSDQL 170
                  8********************************************************************975..44568888876 PP

2trihelix101.95.1e-32424509187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k ev+aLie+r++++ ++ ++  k+plWee+s++m++ g++r++k+Ckekwen+nk++kk+k++ kkr +e+s+tcpyf+ql+a
  Gh_A05G2066 424 RWPKVEVQALIELRTRLDAKYHDNGPKGPLWEEISAAMKKLGYNRNAKRCKEKWENINKYFKKVKDNHKKR-PEDSKTCPYFHQLDA 509
                  8********************************************************************98.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.5E-485147IPR001005SANT/Myb domain
CDDcd122033.71E-2587152No hitNo description
PfamPF138372.1E-1787169No hitNo description
PROSITE profilePS500906.95787145IPR017877Myb-like domain
SMARTSM007172.7E-4421483IPR001005SANT/Myb domain
CDDcd122038.15E-27423488No hitNo description
Gene3DG3DSA:1.10.10.601.8E-4423480IPR009057Homeodomain-like
PfamPF138374.6E-22423510No hitNo description
PROSITE profilePS500907.248423481IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MLGGGGDTTA SVLESGGGGT DGNVTTTAGG GGAVTMGRSG GARDGGSSEG GGVAANNMFG  60
SNGNNNNNSG DEDRVRVDEG DRCFGGNRWP RQETLALLKI RSDMDVTFRD ASVKGPLWEE  120
VSRKLAELGY HRSAKKCKEK FENVFKYHKR TKDVRTGKSD GKTYRFSDQL LALETHPSFQ  180
SPPAMAAVAA PTSPPQAQPQ ATMPAPSLPN VTVPSAAALP SLPQNIVPAN INPTPTLPSF  240
PNVSADQMSN STSSSTSSDL ELEGRRKRKR KWKGFFERLM REVVHEQEEM QKKFLEALEK  300
REQERMAREE AWRMQEMARI NRERELLAQE RSVAAAKDAA LKSLLQKLSE QKNPGQPQSN  360
PPRQPQPTVS VVAAAATPAA VSAALSVPTQ QPPPPLVPQQ PMLNLEVASK SDNGDHSCTP  420
SSSRWPKVEV QALIELRTRL DAKYHDNGPK GPLWEEISAA MKKLGYNRNA KRCKEKWENI  480
NKYFKKVKDN HKKRPEDSKT CPYFHQLDAL YREKNKHDSS STQFKPQNSV PLMVRPEQQW  540
PPLPPSDPDH QHRRDPEDLE SYQNHQDEDG NDEDEDEDED EVEGGEYEIV ASKPVSMGTC  600
E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264269RRKRKR
2264270RRKRKRK
3265270RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.201780.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9637820.0JX963782.1 Gossypium hirsutum clone NBRI_TRANS-1010 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446163.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-141TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D2TVC40.0A0A0D2TVC4_G
STRINGPOPTR_0002s06920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.17e-77Trihelix family protein